Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB27A monoclonal antibody (M02), clone 1G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
More info about RAB27A monoclonal antibody (M02), clone 1G7
| Brand: | Abnova |
| Reference: | H00005873-M02 |
| Product name: | RAB27A monoclonal antibody (M02), clone 1G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB27A. |
| Clone: | 1G7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5873 |
| Gene name: | RAB27A |
| Gene alias: | GS2|HsT18676|MGC117246|RAB27|RAM |
| Gene description: | RAB27A, member RAS oncogene family |
| Genbank accession: | NM_004580 |
| Immunogen: | RAB27A (NP_004571, 122 a.a. ~ 221 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YCENPDIVLCGNKSDLEDQRVVKEEEAIALAEKYGIPYFETSAANGTNISQAIEMLLDLIMKRMERCVDKSWIPEGVVRSNGHASTDQLSEEKEKGACGC |
| Protein accession: | NP_004571 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to RAB27A on formalin-fixed paraffin-embedded human lymphoma. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |
| Publications: | Supporting Role for GTPase Rab27a in Hepatitis C Virus RNA Replication through a Novel miR-122-Mediated Effect.Chen TC, Hsieh CH, Sarnow P. PLoS Pathog. 2015 Aug 25;11(8):e1005116 |