Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB5A monoclonal antibody (M09A), clone 5D1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about RAB5A monoclonal antibody (M09A), clone 5D1
| Brand: | Abnova |
| Reference: | H00005868-M09A |
| Product name: | RAB5A monoclonal antibody (M09A), clone 5D1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB5A. |
| Clone: | 5D1 |
| Isotype: | IgM Kappa |
| Gene id: | 5868 |
| Gene name: | RAB5A |
| Gene alias: | RAB5 |
| Gene description: | RAB5A, member RAS oncogene family |
| Genbank accession: | BC001267 |
| Immunogen: | RAB5A (AAH01267, 116 a.a. ~ 215 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN |
| Protein accession: | AAH01267 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | RAB5A monoclonal antibody (M09A), clone 5D1 Western Blot analysis of RAB5A expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Deregulation of Rab5 and Rab4 proteins in p85R274A-expressing cells alters PDGFR trafficking.Chamberlain MD, Oberg JC, Furber LA, Poland SF, Hawrysh AD, Knafelc SM, McBride HM, Anderson DH. Cellular Signalling (2010), doi: 10.1016/ j.cellsig.2010.05.025 |