Brand: | Abnova |
Reference: | H00005867-M02 |
Product name: | RAB4A monoclonal antibody (M02), clone 1E1 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant RAB4A. |
Clone: | 1E1 |
Isotype: | IgG1 Kappa |
Gene id: | 5867 |
Gene name: | RAB4A |
Gene alias: | HRES-1/RAB4|RAB4 |
Gene description: | RAB4A, member RAS oncogene family |
Genbank accession: | BC004309 |
Immunogen: | RAB4A (AAH04309, 1 a.a. ~ 218 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC |
Protein accession: | AAH04309 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (49.72 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |