Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RGL2 monoclonal antibody (M02), clone 4D10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
More info about RGL2 monoclonal antibody (M02), clone 4D10
| Brand: | Abnova |
| Reference: | H00005863-M02 |
| Product name: | RGL2 monoclonal antibody (M02), clone 4D10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RGL2. |
| Clone: | 4D10 |
| Isotype: | IgG1 |
| Gene id: | 5863 |
| Gene name: | RGL2 |
| Gene alias: | HKE1.5|KE1.5|RAB2L |
| Gene description: | ral guanine nucleotide dissociation stimulator-like 2 |
| Genbank accession: | BC032681 |
| Immunogen: | RGL2 (AAH32681, 644 a.a. ~ 743 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PGASDCRIIRVQMELGEDGSVYKSILVTSQDKAPSVISRVLKKNNRDSAVASEYELVQLLPGERELTIPASANVFYAMDGASHDFLLRQRRRSSTATPGV |
| Protein accession: | AAH32681 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to RGL2 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | M-Ras induces Ral and JNK activation to regulate MEK/ERK-independent gene expression in MCF-7 breast cancer cells.Castro AF, Campos T, Babcock JT, Armijo ME, Martinez-Conde A, Pincheira R, Quilliam LA. J Cell Biochem. 2011 Nov 17. doi: 10.1002/ jcb.23458. |