Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of RAB1A monoclonal antibody (M07A), clone 3F10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about RAB1A monoclonal antibody (M07A), clone 3F10
| Brand: | Abnova |
| Reference: | H00005861-M07A |
| Product name: | RAB1A monoclonal antibody (M07A), clone 3F10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant RAB1A. |
| Clone: | 3F10 |
| Isotype: | IgM Kappa |
| Gene id: | 5861 |
| Gene name: | RAB1A |
| Gene alias: | DKFZp564B163|RAB1|YPT1 |
| Gene description: | RAB1A, member RAS oncogene family |
| Genbank accession: | NM_004161 |
| Immunogen: | RAB1A (NP_004152.1, 106 a.a. ~ 204 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LQEIDRYASENVNKLLVGNKCDLTTKKVVDYTTAKEFADSLGIPFLETSAKNATNVEQSFMTMAAEIKKRMGPGATAGGAEKSNVKIQSTPVKQSGGGC |
| Protein accession: | NP_004152.1 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Rab1A Is an mTORC1 Activator and a Colorectal Oncogene.Thomas JD, Zhang YJ, Wei YH, Cho JH, Morris LE, Wang HY, Zheng XF. Cancer Cell doi:10.1016/ j.ccell.2014.09.008 |