Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PXMP3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PXMP3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005828-A01 |
| Product name: | PXMP3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PXMP3. |
| Gene id: | 5828 |
| Gene name: | PXMP3 |
| Gene alias: | PAF-1|PAF1|PEX2|PMP3|PMP35|RNF72 |
| Gene description: | peroxisomal membrane protein 3, 35kDa |
| Genbank accession: | NM_000318 |
| Immunogen: | PXMP3 (NP_000309, 217 a.a. ~ 305 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | KAKLSSWCIPLTGAPNSDNTLATSGKECALCGEWPTMPHTIGCEHIFCYFCAKSSFLFDVYFTCPKCGTEVHSLQPLKSGIEMSEVNAL |
| Protein accession: | NP_000309 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: |  |
| Application image note: | PXMP3 polyclonal antibody (A01), Lot # 051031JC01 Western Blot analysis of PXMP3 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |