Product successfully added to your shopping cart
Quantity
Total
There are 1 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 749,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 749,00 €
Data sheet of ABCD3 monoclonal antibody (M04), clone 2H6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
More info about ABCD3 monoclonal antibody (M04), clone 2H6
| Brand: | Abnova |
| Reference: | H00005825-M04 |
| Product name: | ABCD3 monoclonal antibody (M04), clone 2H6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCD3. |
| Clone: | 2H6 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5825 |
| Gene name: | ABCD3 |
| Gene alias: | ABC43|PMP70|PXMP1 |
| Gene description: | ATP-binding cassette, sub-family D (ALD), member 3 |
| Genbank accession: | NM_002858 |
| Immunogen: | ABCD3 (NP_002849.1, 351 a.a. ~ 449 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT |
| Protein accession: | NP_002849.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ABCD3 is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |