Brand: | Abnova |
Reference: | H00005825-M04 |
Product name: | ABCD3 monoclonal antibody (M04), clone 2H6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ABCD3. |
Clone: | 2H6 |
Isotype: | IgG2a Kappa |
Gene id: | 5825 |
Gene name: | ABCD3 |
Gene alias: | ABC43|PMP70|PXMP1 |
Gene description: | ATP-binding cassette, sub-family D (ALD), member 3 |
Genbank accession: | NM_002858 |
Immunogen: | ABCD3 (NP_002849.1, 351 a.a. ~ 449 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SELLEDYYQSGRMLLRMSQALGRIVLAGREMTRLAGFTARITELMQVLKDLNHGKYERTMVSQQEKGIEGVQVIPLIPGAGEIIIADNIIKFDHVPLAT |
Protein accession: | NP_002849.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged ABCD3 is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA |
Shipping condition: | Dry Ice |