PEX19 monoclonal antibody (M07), clone 2E4 View larger

PEX19 monoclonal antibody (M07), clone 2E4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PEX19 monoclonal antibody (M07), clone 2E4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,WB-Tr

More info about PEX19 monoclonal antibody (M07), clone 2E4

Brand: Abnova
Reference: H00005824-M07
Product name: PEX19 monoclonal antibody (M07), clone 2E4
Product description: Mouse monoclonal antibody raised against a full-length recombinant PEX19.
Clone: 2E4
Isotype: IgG2a Kappa
Gene id: 5824
Gene name: PEX19
Gene alias: D1S2223E|HK33|PMP1|PMPI|PXF|PXMP1
Gene description: peroxisomal biogenesis factor 19
Genbank accession: BC000496
Immunogen: PEX19 (AAH00496, 1 a.a. ~ 299 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MAAAEEGCSVGAEADRELEELLESALDDFDKAKPSPAPPSTTTAPDASGPQKRSPGDTAKDALFASQEKFFQELFDSELASQATAEFEKAMKELAEEEPHLVEQFQKLSEAAGRVGSDMTSQQEFTSCLKETLSGLAKNATDLQNSSMSEEELTKAMEGLGMDEGDGEGNILPIMQGIMQNLLSKDVLYPSLKEITEKYPEWLQSHRESLPPEQFEKYQEQHSVMCKICEQFEAETPTDSETTQKARFEMVLDLMQQLQDLGHPPKELAGEMPPGLNFDLDAPNLSGPPGASGEQCLIM
Protein accession: AAH00496
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005824-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (58.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005824-M07-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged PEX19 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PEX19 monoclonal antibody (M07), clone 2E4 now

Add to cart