Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PVRL1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA |
More info about PVRL1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005818-A01 |
| Product name: | PVRL1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PVRL1. |
| Gene id: | 5818 |
| Gene name: | PVRL1 |
| Gene alias: | CD111|CLPED1|ED4|HIgR|HVEC|MGC142031|MGC16207|OFC7|PRR|PRR1|PVRR|PVRR1|SK-12|nectin-1 |
| Gene description: | poliovirus receptor-related 1 (herpesvirus entry mediator C) |
| Genbank accession: | NM_002855 |
| Immunogen: | PVRL1 (NP_002846, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | VQVNDSMYGFIGTDVVLHCSFANPLPSVKITQVTWQKSTNGSKQNVAIYNPSMGVSVLAPYRERVEFLRPSFTDGTIRLSRLELEDEGVYICEFATFPTGNRESQLNLTV |
| Protein accession: | NP_002846 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PVRL1 polyclonal antibody (A01), Lot # 050913JC01 Western Blot analysis of PVRL1 expression in A-431 ( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA |
| Shipping condition: | Dry Ice |