Cart 3 Product Products 14 286,67 € (empty)
No products
To be determined Shipping
14 286,67 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 3 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 14 286,67 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 14 286,67 €
Data sheet of PURA monoclonal antibody (M07), clone 1D6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ti,IF,ELISA,WB-Re |
More info about PURA monoclonal antibody (M07), clone 1D6
| Brand: | Abnova |
| Reference: | H00005813-M07 |
| Product name: | PURA monoclonal antibody (M07), clone 1D6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PURA. |
| Clone: | 1D6 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5813 |
| Gene name: | PURA |
| Gene alias: | PUR-ALPHA|PUR1|PURALPHA |
| Gene description: | purine-rich element binding protein A |
| Genbank accession: | NM_005859 |
| Immunogen: | PURA (NP_005850, 183 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC |
| Protein accession: | NP_005850 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PURA monoclonal antibody (M07), clone 1D6. Western Blot analysis of PURA expression in human skeletal muscle. |
| Applications: | WB-Ti,IF,ELISA,WB-Re |
| Shipping condition: | Dry Ice |