No products
Prices are tax excluded
| Brand | Abnova | 
| Product type | Primary antibodies | 
| Reactivity | Human,Rat | 
| Host species | Mouse | 
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re | 
| Brand: | Abnova | 
| Reference: | H00005813-M02 | 
| Product name: | PURA monoclonal antibody (M02), clone 1C10 | 
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PURA. | 
| Clone: | 1C10 | 
| Isotype: | IgG2a Kappa | 
| Gene id: | 5813 | 
| Gene name: | PURA | 
| Gene alias: | PUR-ALPHA|PUR1|PURALPHA | 
| Gene description: | purine-rich element binding protein A | 
| Genbank accession: | NM_005859 | 
| Immunogen: | PURA (NP_005850, 183 a.a. ~ 292 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence: | TQGQTIALPAQGLIEFRDALAKLIDDYGVEEEPAELPEGTSLTVDNKRFFFDVGSNKYGVFMRVSEVKPTYRNSITVPYKVWAKFGHTFCKYSEETKKIQEKQREKRAAC | 
| Protein accession: | NP_005850 | 
| Storage buffer: | In 1x PBS, pH 7.4 | 
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing: | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture: | ![]()  | 
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . | 
| Product type: | Primary antibodies | 
| Host species: | Mouse | 
| Antigen species / target species: | Human | 
| Reactivity: | Human,Rat | 
| Application image: | ![]()  | 
| Application image note: | PURA monoclonal antibody (M02), clone 1C10. Western Blot analysis of PURA expression in PC-12 ( Cat # L012V1 ). | 
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re | 
| Shipping condition: | Dry Ice |