| Brand:  | Abnova | 
| Reference:  | H00005810-M04 | 
| Product name:  | RAD1 monoclonal antibody (M04), clone 1A12 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant RAD1. | 
| Clone:  | 1A12 | 
| Isotype:  | IgG3 Kappa | 
| Gene id:  | 5810 | 
| Gene name:  | RAD1 | 
| Gene alias:  | HRAD1|REC1 | 
| Gene description:  | RAD1 homolog (S. pombe) | 
| Genbank accession:  | BC006837 | 
| Immunogen:  | RAD1 (AAH06837, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL | 
| Protein accession:  | AAH06837 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (35.53 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Detection limit for recombinant GST tagged RAD1 is approximately 1ng/ml as a capture antibody. | 
| Applications:  | S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice |