Brand: | Abnova |
Reference: | H00005810-M01 |
Product name: | RAD1 monoclonal antibody (M01), clone 1G2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant RAD1. |
Clone: | 1G2 |
Isotype: | IgG3 Kappa |
Gene id: | 5810 |
Gene name: | RAD1 |
Gene alias: | HRAD1|REC1 |
Gene description: | RAD1 homolog (S. pombe) |
Genbank accession: | BC006837 |
Immunogen: | RAD1 (AAH06837, 1 a.a. ~ 90 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MPLLTQQIQDEDDQYSLVASLDNVRNLSTILKAIHFREHATCFATKNGIKVTVENAKCVQANAFIQAGIFQEFKVQEESVTFRINLTVLL |
Protein accession: | AAH06837 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (35.53 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to RAD1 on formalin-fixed paraffin-embedded human lateral ventricle wall. [antibody concentration 3 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |