Cart 13 Product Products 4 943,00 € (empty)
No products
To be determined Shipping
4 943,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 13 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 4 943,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 4 943,00 €
Data sheet of PTX3 monoclonal antibody (M01), clone 5B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse,Rat |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
More info about PTX3 monoclonal antibody (M01), clone 5B7
| Brand: | Abnova |
| Reference: | H00005806-M01 |
| Product name: | PTX3 monoclonal antibody (M01), clone 5B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTX3. |
| Clone: | 5B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5806 |
| Gene name: | PTX3 |
| Gene alias: | TNFAIP5|TSG-14 |
| Gene description: | pentraxin-related gene, rapidly induced by IL-1 beta |
| Genbank accession: | NM_002852 |
| Immunogen: | PTX3 (NP_002843, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV |
| Protein accession: | NP_002843 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | PTX3 monoclonal antibody (M01), clone 5B7. Western Blot analysis of PTX3 expression in NIH/3T3 ( Cat # L018V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Prenatal Exposure to Lipopolysaccharide Induces PTX3 Expression and Results in Obesity in Mouse Offspring.Qin S, Chen X, Gao M, Zhou J, Li X. Inflammation. 2017 Aug 2. [Epub ahead of print] |