Brand: | Abnova |
Reference: | H00005806-M01 |
Product name: | PTX3 monoclonal antibody (M01), clone 5B7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTX3. |
Clone: | 5B7 |
Isotype: | IgG1 Kappa |
Gene id: | 5806 |
Gene name: | PTX3 |
Gene alias: | TNFAIP5|TSG-14 |
Gene description: | pentraxin-related gene, rapidly induced by IL-1 beta |
Genbank accession: | NM_002852 |
Immunogen: | PTX3 (NP_002843, 282 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | SLWVNGELAATTVEMATGHIVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIRGNIVGWGVTEIQPHGGAQYV |
Protein accession: | NP_002843 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | PTX3 monoclonal antibody (M01), clone 5B7. Western Blot analysis of PTX3 expression in NIH/3T3 ( Cat # L018V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Prenatal Exposure to Lipopolysaccharide Induces PTX3 Expression and Results in Obesity in Mouse Offspring.Qin S, Chen X, Gao M, Zhou J, Li X. Inflammation. 2017 Aug 2. [Epub ahead of print] |