Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005798-M07 |
Product name: | PTPRN monoclonal antibody (M07), clone 8E3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTPRN. |
Clone: | 8E3 |
Isotype: | IgG2a Kappa |
Gene id: | 5798 |
Gene name: | PTPRN |
Gene alias: | FLJ16131|IA-2|IA-2/PTP|IA2|ICA512|R-PTP-N |
Gene description: | protein tyrosine phosphatase, receptor type, N |
Genbank accession: | NM_002846 |
Immunogen: | PTPRN (NP_002837, 205 a.a. ~ 311 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | LLQPYLFHQFGSRDGSRVSEGSPGMVSVGPLPKAEAPALFSRTASKGIFGDHPGHSYGDLPGPSPAQLFQDSGLLYLAQELPAPSRARVPRLPEQGSSSRAEDSPEG |
Protein accession: | NP_002837 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.4 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PTPRN expression in transfected 293T cell line by PTPRN monoclonal antibody (M07), clone 8E3. Lane 1: PTPRN transfected lysate (Predicted MW: 65.01 KDa). Lane 2: Non-transfected lysate. |
Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |