Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTPRE polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PTPRE polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005791-A01 |
| Product name: | PTPRE polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PTPRE. |
| Gene id: | 5791 |
| Gene name: | PTPRE |
| Gene alias: | DKFZp313F1310|FLJ57799|FLJ58245|HPTPE|PTPE|R-PTP-EPSILON |
| Gene description: | protein tyrosine phosphatase, receptor type, E |
| Genbank accession: | BC050062 |
| Immunogen: | PTPRE (AAH50062, 511 a.a. ~ 600 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | WRMIWEWKSHTIVMLTEVQEREQDKCYQYWPTEGSVTHGEITIEIKNDTLSEAISIRDFLVTLNQPQARQEEQVRVVRQFHFHGWPEIGI |
| Protein accession: | AAH50062 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.01 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PTPRE polyclonal antibody (A01), Lot # 051017JC01 Western Blot analysis of PTPRE expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |