Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTPRC monoclonal antibody (M12), clone 3D3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PTPRC monoclonal antibody (M12), clone 3D3
| Reference: | H00005788-M12 |
| Product name: | PTPRC monoclonal antibody (M12), clone 3D3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTPRC. |
| Clone: | 3D3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5788 |
| Gene name: | PTPRC |
| Gene alias: | B220|CD45|CD45R|GP180|LCA|LY5|T200 |
| Gene description: | protein tyrosine phosphatase, receptor type, C |
| Genbank accession: | NM_002838 |
| Immunogen: | PTPRC (NP_002829.2, 390 a.a. ~ 570 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PGEPQIIFCRSEAAHQGVITWNPPQRSFHNFTLCYIKETEKDCLNLDKNLIKYDLQNLKPYTKYVLSLHAYIIAKVQRNGSAAMCHFTTKSAPPSQVWNMTVSMTSDNSMHVKCRPPRDRNGPHERYHLEVEAGNTLVRNESHKNCDFRVKDLQYSTDYTFKAYFHNGDYPGEPFILHHST |
| Protein accession: | NP_002829.2 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |