Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTPN13 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PTPN13 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005783-A01 |
| Product name: | PTPN13 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PTPN13. |
| Gene id: | 5783 |
| Gene name: | PTPN13 |
| Gene alias: | DKFZp686J1497|FAP-1|PNP1|PTP-BAS|PTP-BL|PTP1E|PTPL1|PTPLE |
| Gene description: | protein tyrosine phosphatase, non-receptor type 13 (APO-1/CD95 (Fas)-associated phosphatase) |
| Genbank accession: | NM_006264 |
| Immunogen: | PTPN13 (NP_006255, 66 a.a. ~ 175 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | FTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQPIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKL |
| Protein accession: | NP_006255 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |