No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re,WB-Tr |
Brand: | Abnova |
Reference: | H00005782-M01 |
Product name: | PTPN12 monoclonal antibody (M01), clone 4G6 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PTPN12. |
Clone: | 4G6 |
Isotype: | IgG2a Kappa |
Gene id: | 5782 |
Gene name: | PTPN12 |
Gene alias: | PTP-PEST|PTPG1 |
Gene description: | protein tyrosine phosphatase, non-receptor type 12 |
Genbank accession: | NM_002835 |
Immunogen: | PTPN12 (NP_002826.2, 682 a.a. ~ 779 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | PESFVLASEHNTPVRSEWSELQSQERSEQKKSEGLITSENEKCDHPAGGIHYEMCIECPPTFSDKREQISENPTEATDIGFGNRCGKPKGPRDPPSEW |
Protein accession: | NP_002826.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.52 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of PTPN12 expression in transfected 293T cell line by PTPN12 monoclonal antibody (M01), clone 4G6. Lane 1: PTPN12 transfected lysate(88.1 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |