| Brand:  | Abnova | 
| Reference:  | H00005764-M01 | 
| Product name:  | PTN monoclonal antibody (M01), clone 5C3 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PTN. | 
| Clone:  | 5C3 | 
| Isotype:  | IgG1 Kappa | 
| Gene id:  | 5764 | 
| Gene name:  | PTN | 
| Gene alias:  | HARP|HBGF8|HBNF|NEGF1 | 
| Gene description:  | pleiotrophin | 
| Genbank accession:  | NM_002825 | 
| Immunogen:  | PTN (NP_002816, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK | 
| Protein accession:  | NP_002816 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (37.84 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | Immunoperoxidase of monoclonal antibody to PTN on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml] | 
| Applications:  | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice | 
| Publications:  | Pleiotrophin promotes microglia proliferation and secretion of neurotrophic factors by activating extracellular signal-regulated kinase 1/2 pathway.Miao J, Ding M, Zhang A, Xiao Z, Qi W, Luo N, Di W, Tao Y, Fang Y. Neurosci Res. 2012 Sep 18. pii: S0168-0102(12)00173-3. doi: 10.1016/j.neures.2012.09.001. [Epub ahead of print] |