Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PTN monoclonal antibody (M01), clone 5C3
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about PTN monoclonal antibody (M01), clone 5C3
| Brand: | Abnova |
| Reference: | H00005764-M01 |
| Product name: | PTN monoclonal antibody (M01), clone 5C3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTN. |
| Clone: | 5C3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5764 |
| Gene name: | PTN |
| Gene alias: | HARP|HBGF8|HBNF|NEGF1 |
| Gene description: | pleiotrophin |
| Genbank accession: | NM_002825 |
| Immunogen: | PTN (NP_002816, 45 a.a. ~ 154 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESK |
| Protein accession: | NP_002816 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PTN on formalin-fixed paraffin-embedded human cerebral cortex. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Pleiotrophin promotes microglia proliferation and secretion of neurotrophic factors by activating extracellular signal-regulated kinase 1/2 pathway.Miao J, Ding M, Zhang A, Xiao Z, Qi W, Luo N, Di W, Tao Y, Fang Y. Neurosci Res. 2012 Sep 18. pii: S0168-0102(12)00173-3. doi: 10.1016/j.neures.2012.09.001. [Epub ahead of print] |