PTHR1 polyclonal antibody (A02) View larger

PTHR1 polyclonal antibody (A02)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PTHR1 polyclonal antibody (A02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PTHR1 polyclonal antibody (A02)

Brand: Abnova
Reference: H00005745-A02
Product name: PTHR1 polyclonal antibody (A02)
Product description: Mouse polyclonal antibody raised against a partial recombinant PTHR1.
Gene id: 5745
Gene name: PTH1R
Gene alias: MGC138426|MGC138452|PTHR|PTHR1
Gene description: parathyroid hormone 1 receptor
Genbank accession: NM_000316
Immunogen: PTHR1 (NP_000307, 27 a.a. ~ 134 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DADDVMTKEEQIFLLHRAQAQCEKRLKEVLQRPASIMESDKGWTSASTSGKPRKDKASGKLYPESEEDKEAPTGSRYRGRPCLPEWDHILCWPLGAPGEVVAVPCPDY
Protein accession: NP_000307
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005745-A02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.99 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005745-A02-1-7-1.jpg
Application image note: PTHR1 polyclonal antibody (A02), Lot # 051207JC01 Western Blot analysis of PTHR1 expression in MCF-7 ( Cat # L046V1 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PTHR1 polyclonal antibody (A02) now

Add to cart