| Brand: | Abnova |
| Reference: | H00005739-M02 |
| Product name: | PTGIR monoclonal antibody (M02), clone 2A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTGIR. |
| Clone: | 2A7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5739 |
| Gene name: | PTGIR |
| Gene alias: | IP|MGC102830|PRIPR |
| Gene description: | prostaglandin I2 (prostacyclin) receptor (IP) |
| Genbank accession: | NM_000960 |
| Immunogen: | PTGIR (NP_000951, 296 a.a. ~ 386 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RKAVFQRLKLWVCCLCLGPAHGDSQTPLSQLASGRRDPRAPSAPVGKEGSCVPLSAWGEGQVEPLPPTQQSSGSAVGTSSKAEASVACSLC |
| Protein accession: | NP_000951 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.75 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PTGIR is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |