| Brand: | Abnova |
| Reference: | H00005728-M02A |
| Product name: | PTEN monoclonal antibody (M02A), clone 3E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTEN. |
| Clone: | 3E7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5728 |
| Gene name: | PTEN |
| Gene alias: | 10q23del|BZS|MGC11227|MHAM|MMAC1|PTEN1|TEP1 |
| Gene description: | phosphatase and tensin homolog |
| Genbank accession: | NM_000314.1 |
| Immunogen: | PTEN (NP_000305.1, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFE |
| Protein accession: | NP_000305 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.41 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PTEN monoclonal antibody (M02A), clone 3E7 Western Blot analysis of PTEN expression in C32 ( Cat # L002V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |