| Brand:  | Abnova | 
| Reference:  | H00005728-M02A | 
| Product name:  | PTEN monoclonal antibody (M02A), clone 3E7 | 
| Product description:  | Mouse monoclonal antibody raised against a partial recombinant PTEN. | 
| Clone:  | 3E7 | 
| Isotype:  | IgG2a Kappa | 
| Gene id:  | 5728 | 
| Gene name:  | PTEN | 
| Gene alias:  | 10q23del|BZS|MGC11227|MHAM|MMAC1|PTEN1|TEP1 | 
| Gene description:  | phosphatase and tensin homolog | 
| Genbank accession:  | NM_000314.1 | 
| Immunogen:  | PTEN (NP_000305.1, 2 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | TAIIKEIVSRNKRRYQEDGFDLDLTYIYPNIIAMGFPAERLEGVYRNNIDDVVRFLDSKHKNHYKIYNLCAERHYDTAKFNCRVAQYPFE | 
| Protein accession:  | NP_000305 | 
| Storage buffer:  | In ascites fluid | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (35.41 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | PTEN monoclonal antibody (M02A), clone 3E7 Western Blot analysis of PTEN expression in C32 ( Cat # L002V1 ). | 
| Applications:  | WB-Ce,ELISA,WB-Re | 
| Shipping condition:  | Dry Ice |