| Brand: | Abnova |
| Reference: | H00005727-M05A |
| Product name: | PTCH monoclonal antibody (M05A), clone 1B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PTCH. |
| Clone: | 1B7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5727 |
| Gene name: | PTCH1 |
| Gene alias: | BCNS|FLJ26746|FLJ42602|HPE7|NBCCS|PTC|PTC1|PTCH|PTCH11 |
| Gene description: | patched homolog 1 (Drosophila) |
| Genbank accession: | NM_000264 |
| Immunogen: | PTCH (NP_000255, 841 a.a. ~ 940 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PKMWLHYFRDWLQGLQDAFDSDWETGKIMPNNYKNGSDDGVLAYKLLVQTGSRDKPIDISQLTKQRLVDADGIINPSAFYIYLTAWVSNDPVAYAASQAN |
| Protein accession: | NP_000255 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |