| Brand:  | Abnova | 
| Reference:  | H00005723-M02 | 
| Product name:  | PSPH monoclonal antibody (M02), clone 2G9 | 
| Product description:  | Mouse monoclonal antibody raised against a full length recombinant PSPH. | 
| Clone:  | 2G9 | 
| Isotype:  | IgG1 kappa | 
| Gene id:  | 5723 | 
| Gene name:  | PSPH | 
| Gene alias:  | PSP | 
| Gene description:  | phosphoserine phosphatase | 
| Genbank accession:  | BC063614 | 
| Immunogen:  | PSPH (AAH63614, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. | 
| Immunogen sequence/protein sequence:  | MVSHSELRKLFYSADAVCFDVDSTVIREEGIDELAKICGVEDAVSEMTRRAMGGAVPFKAALTERLALIQPSREQVQRLIAEQPPHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASKLNIPATNVFANRLKFYFNGEYAGFDETQPTAESGGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKDNAKWYITDFVELLGELEE | 
| Protein accession:  | AAH63614 | 
| Storage buffer:  | In 1x PBS, pH 7.4 | 
| Storage instruction:  | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. | 
| Quality control testing:  | Antibody Reactive Against Recombinant Protein. | 
| Quality control testing picture:  |   | 
| Quality control testing picture note:  | Western Blot detection against Immunogen (50.49 KDa) . | 
| Product type:  | Primary antibodies | 
| Host species:  | Mouse | 
| Antigen species / target species:  | Human | 
| Reactivity:  | Human | 
| Application image:  |   | 
| Application image note:  | PSPH monoclonal antibody (M02), clone 2G9 Western Blot analysis of PSPH expression in K-562 ( Cat # L009V1 ). | 
| Applications:  | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr | 
| Shipping condition:  | Dry Ice |