No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00005718-A01 |
Product name: | PSMD12 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PSMD12. |
Gene id: | 5718 |
Gene name: | PSMD12 |
Gene alias: | MGC75406|Rpn5|p55 |
Gene description: | proteasome (prosome, macropain) 26S subunit, non-ATPase, 12 |
Genbank accession: | NM_002816 |
Immunogen: | PSMD12 (NP_002807, 347 a.a. ~ 456 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | GEKRWKDLKNRVVEHNIRIMAKYYTRITMKRMAQLLDLSVDESEAFLSNLVVNKTIFAKVDRLAGIINFQRPKDPNNLLNDWSQKLNSLMSLVNKTTHLIAKEEMIHNLQ |
Protein accession: | NP_002807 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |