| Brand: | Abnova |
| Reference: | H00005706-M02 |
| Product name: | PSMC6 monoclonal antibody (M02), clone 2C4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMC6. |
| Clone: | 2C4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5706 |
| Gene name: | PSMC6 |
| Gene alias: | CADP44|MGC12520|P44|SUG2|p42 |
| Gene description: | proteasome (prosome, macropain) 26S subunit, ATPase, 6 |
| Genbank accession: | BC005390 |
| Immunogen: | PSMC6 (AAH05390, 290 a.a. ~ 389 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LRPGRLDRKIHIDLPNEQARLDILKIHAGPITKHGEIDYEAIVKLSDGFNGADLRNVCTEAGMFAIRADHDFVVQEDFMKAVRKVADSKKLESKLDYKPV |
| Protein accession: | AAH05390 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | PSMC6 monoclonal antibody (M02), clone 2C4 Western Blot analysis of PSMC6 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |