| Brand: | Abnova |
| Reference: | H00005696-M04 |
| Product name: | PSMB8 monoclonal antibody (M04), clone 2F4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PSMB8. |
| Clone: | 2F4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5696 |
| Gene name: | PSMB8 |
| Gene alias: | D6S216|D6S216E|LMP7|MGC1491|PSMB5i|RING10|beta5i |
| Gene description: | proteasome (prosome, macropain) subunit, beta type, 8 (large multifunctional peptidase 7) |
| Genbank accession: | BC001114 |
| Immunogen: | PSMB8 (AAH01114, 173 a.a. ~ 272 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DKKGPGLYYVDEHGTRLSGNMFSTGSGNTYAYGVMDSGYRPNLSPEEAYDLGRRAIAYATHRDSYSGGVVNMYHMKEDGWVKVESTDVSDLLHQYREANQ |
| Protein accession: | AAH01114 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged PSMB8 is approximately 10ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |