| Brand: | Abnova |
| Reference: | H00005655-M01A |
| Product name: | KLK10 monoclonal antibody (M01A), clone 1G8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLK10. |
| Clone: | 1G8 |
| Isotype: | IgG1 Lambda |
| Gene id: | 5655 |
| Gene name: | KLK10 |
| Gene alias: | NES1|PRSSL1 |
| Gene description: | kallikrein-related peptidase 10 |
| Genbank accession: | NM_002776 |
| Immunogen: | KLK10 (NP_002767, 167 a.a. ~ 276 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DQCQVAGWGTTAARRVKYNKGLTCSSITILSPKECEVFYPGVVTNNMICAGLDRGQDPCQSDSGGPLVCDETLQGILSWGVYPCGSAQHPAVYTQICKYMSWINKVIRSN |
| Protein accession: | NP_002767 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | KLK10 monoclonal antibody (M01A), clone 1G8 Western Blot analysis of KLK10 expression in A-431( Cat # L015V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |