Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of KLK6 monoclonal antibody (M01), clone 4A10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about KLK6 monoclonal antibody (M01), clone 4A10
| Brand: | Abnova |
| Reference: | H00005653-M01 |
| Product name: | KLK6 monoclonal antibody (M01), clone 4A10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant KLK6. |
| Clone: | 4A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5653 |
| Gene name: | KLK6 |
| Gene alias: | Bssp|Klk7|MGC9355|NEUROSIN|PRSS18|PRSS9|SP59|ZYME|hK6 |
| Gene description: | kallikrein-related peptidase 6 |
| Genbank accession: | BC015525 |
| Immunogen: | KLK6 (AAH15525, 91 a.a. ~ 190 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RAVIHPDYDAASHDQDIMLLRLARPAKLSELIQPLPLERDCSANTTSCHILGWGKTADGDFPDTIQCAYIHLVSREECEHAYPGQITQNMLCAGDEKYGK |
| Protein accession: | AAH15525 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged KLK6 is approximately 0.3ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Correlation between KLK6 expression and the clinicopathological features of glioma.Lou J, Si H, Chen Y, Sun X, Zhang H, Niu A, Hu C Contemp Oncol (Pozn). 2014;18(4):246-51. doi: 10.5114/wo.2014.44628. Epub 2014 Aug 30. |