| Brand: | Abnova |
| Reference: | H00005644-B01P |
| Product name: | PRSS1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human PRSS1 protein. |
| Gene id: | 5644 |
| Gene name: | PRSS1 |
| Gene alias: | MGC120175|MGC149362|TRP1|TRY1|TRY4|TRYP1 |
| Gene description: | protease, serine, 1 (trypsin 1) |
| Genbank accession: | NM_002769.2 |
| Immunogen: | PRSS1 (NP_002760.1, 1 a.a. ~ 247 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MNPLLILTFVAAALAAPFDDDDKIVGGYNCEENSVPYQVSLNSGYHFCGGSLINEQWVVSAGHCYKSRIQVRLGEHNIEVLEGNEQFINAAKIIRHPQYDRKTLNNDIMLIKLSSRAVINARVSTISLPTAPPATGTKCLISGWGNTASSGADYPDELQCLDAPVLSQAKCEASYPGKITSNMFCVGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGDGCAQKNKPGVYTKVYNYVKWIKNTIAANS |
| Protein accession: | NP_002760.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PRSS1 MaxPab polyclonal antibody. Western Blot analysis of PRSS1 expression in human pancreas. |
| Applications: | WB-Ti,WB-Tr |
| Shipping condition: | Dry Ice |