PRPS2 polyclonal antibody (A01) View larger

PRPS2 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPS2 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about PRPS2 polyclonal antibody (A01)

Brand: Abnova
Reference: H00005634-A01
Product name: PRPS2 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant PRPS2.
Gene id: 5634
Gene name: PRPS2
Gene alias: PRSII
Gene description: phosphoribosyl pyrophosphate synthetase 2
Genbank accession: NM_002765
Immunogen: PRPS2 (NP_002756, 160 a.a. ~ 269 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: AEWKNCIIVSPDAGGAKRVTSIADRLNVEFALIHKERKKANEVDRMVLVGDVKDRVAILVDDMADTCGTICHAADKLLSAGATKVYAILTHGIFSGPAISRINNAAFEAV
Protein accession: NP_002756
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005634-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (38.21 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005634-A01-1-75-1.jpg
Application image note: PRPS2 polyclonal antibody (A01), Lot # 051212JC01. Western Blot analysis of PRPS2 expression in Daoy.
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Direct role of nucleotide metabolism in C-MYC-dependent proliferation of melanoma cells.Mannava S, Grachtchouk V, Wheeler LJ, Im M, Zhuang D, Slavina EG, Mathews CK, Shewach DS, Nikiforov MA.
Cell Cycle. 2008 Aug;7(15):2392-400. Epub 2008 Jun 3.

Reviews

Buy PRPS2 polyclonal antibody (A01) now

Add to cart