| Brand: | Abnova |
| Reference: | H00005618-M02 |
| Product name: | PRLR monoclonal antibody (M02), clone 1E4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRLR. |
| Clone: | 1E4 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5618 |
| Gene name: | PRLR |
| Gene alias: | hPRLrI |
| Gene description: | prolactin receptor |
| Genbank accession: | NM_000949 |
| Immunogen: | PRLR (NP_000940.1, 371 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PSTFYDPEVIEKPENPETTHTWDPQCISMEGKIPYFHAGGSKCSTWPLPQPSQHNPRSSYHNITDVCELAVGPAGAPATLLNEAGKDALKSSQTIKSREEGKATQQREV |
| Protein accession: | NP_000940.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PRLR monoclonal antibody (M02), clone 1E4. Western Blot analysis of PRLR expression in A-431(Cat # L015V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |