Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRKRIR monoclonal antibody (M01), clone 1C10-1A6
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about PRKRIR monoclonal antibody (M01), clone 1C10-1A6
| Brand: | Abnova |
| Reference: | H00005612-M01 |
| Product name: | PRKRIR monoclonal antibody (M01), clone 1C10-1A6 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PRKRIR. |
| Clone: | 1C10-1A6 |
| Isotype: | IgG1 kappa |
| Gene id: | 5612 |
| Gene name: | PRKRIR |
| Gene alias: | DAP4|MGC102750|P52rIPK |
| Gene description: | protein-kinase, interferon-inducible double stranded RNA dependent inhibitor, repressor of (P58 repressor) |
| Genbank accession: | BC021992 |
| Immunogen: | PRKRIR (AAH21992, 1 a.a. ~ 150 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGQLKFNTSEEHHADMYRSDLPNPDTLSAELHCWRIKWKHRGKDIELPSTIYEALHLPDIKFFPNVYALLKVLCILPVMKVENERYENGRKRLKAYLRNTLTDQRSSNLALLNINFDIKHDLDLMVDTYIKLYTSKSELPTDNSETVENT |
| Protein accession: | AAH21992 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |