| Brand: | Abnova |
| Reference: | H00005607-M06 |
| Product name: | MAP2K5 monoclonal antibody (M06), clone 1F6 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAP2K5. |
| Clone: | 1F6 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5607 |
| Gene name: | MAP2K5 |
| Gene alias: | HsT17454|MAPKK5|MEK5|PRKMK5 |
| Gene description: | mitogen-activated protein kinase kinase 5 |
| Genbank accession: | BC008838 |
| Immunogen: | MAP2K5 (AAH08838, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLWLALGPFPAMENQVLVIRIKIPNSGAVDWTVHSGPQLLFRDVLDVIGQVLPEATTTAFEYEDEDGDRITVRSDEEMKAMLSYYYSTVMEQQVNGQLIEPLQIFPRACKPPGERNIHGL |
| Protein accession: | AAH08838 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.83 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | http://www.abnova.com/application_image/ |
| Application image note: | Detection limit for recombinant GST tagged MAP2K5 is approximately 10ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |