MAP2K3 monoclonal antibody (M02), clone 1D10 View larger

MAP2K3 monoclonal antibody (M02), clone 1D10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MAP2K3 monoclonal antibody (M02), clone 1D10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP

More info about MAP2K3 monoclonal antibody (M02), clone 1D10

Brand: Abnova
Reference: H00005606-M02
Product name: MAP2K3 monoclonal antibody (M02), clone 1D10
Product description: Mouse monoclonal antibody raised against a partial recombinant MAP2K3.
Clone: 1D10
Isotype: IgG1 Kappa
Gene id: 5606
Gene name: MAP2K3
Gene alias: MAPKK3|MEK3|MKK3|PRKMK3
Gene description: mitogen-activated protein kinase kinase 3
Genbank accession: BC032478
Immunogen: MAP2K3 (AAH32478, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MESPASSQPASMPQSKGKSKRKKDLRISCMSKPPAPNPTPPRNLDSRTFITIGDRNFEVEADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVN
Protein accession: AAH32478
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00005606-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00005606-M02-3-20-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to MAP2K3 on formalin-fixed paraffin-embedded human dysgerminoma. [antibody concentration 3 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re,WB-Tr,IP
Shipping condition: Dry Ice

Reviews

Buy MAP2K3 monoclonal antibody (M02), clone 1D10 now

Add to cart