| Brand: | Abnova |
| Reference: | H00005603-M03 |
| Product name: | MAPK13 monoclonal antibody (M03), clone 1E11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK13. |
| Clone: | 1E11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5603 |
| Gene name: | MAPK13 |
| Gene alias: | MGC99536|PRKM13|SAPK4|p38delta |
| Gene description: | mitogen-activated protein kinase 13 |
| Genbank accession: | BC000433 |
| Immunogen: | MAPK13 (AAH00433, 251 a.a. ~ 365 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NDKAAKSYIQSLPQTPRKDFTQLFPRASPQAADLLEKMLELDVDRRLTAAQALTHPFFEPFRDPEEETEAQQPFDDSLEHEKLTVDEWKQHIYKEIVNFSPIARKDSRRRSGMKL |
| Protein accession: | AAH00433 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.28 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to MAPK13 on formalin-fixed paraffin-embedded human small Intestine. [antibody concentration 1 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |