Brand: | Abnova |
Reference: | H00005601-M03 |
Product name: | MAPK9 monoclonal antibody (M03), clone 3C12 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK9. |
Clone: | 3C12 |
Isotype: | IgG2a Kappa |
Gene id: | 5601 |
Gene name: | MAPK9 |
Gene alias: | JNK-55|JNK2|JNK2A|JNK2ALPHA|JNK2B|JNK2BETA|PRKM9|SAPK|p54a|p54aSAPK |
Gene description: | mitogen-activated protein kinase 9 |
Genbank accession: | BC032539 |
Immunogen: | MAPK9 (AAH32539, 321 a.a. ~ 424 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | ITVWYDPAEAEAPPPQIYDAQLEEREHAIEEWKELIYKEVMDWEERSKNGVVKDQPSDAAVSSNATPSQSSSINDISSMSTEQTLASDTDSSLDASTGPLEGCR |
Protein accession: | AAH32539 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MAPK9 on HeLa cell. [antibody concentration 10 ug/ml] |
Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |