| Brand: | Abnova |
| Reference: | H00005600-M03 |
| Product name: | MAPK11 monoclonal antibody (M03), clone 1F9 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK11. |
| Clone: | 1F9 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5600 |
| Gene name: | MAPK11 |
| Gene alias: | P38B|P38BETA2|PRKM11|SAPK2|SAPK2B|p38-2|p38Beta |
| Gene description: | mitogen-activated protein kinase 11 |
| Genbank accession: | BC027933 |
| Immunogen: | MAPK11 (AAH27933, 255 a.a. ~ 364 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ARTYIQSLPPMPQKDLSSIFRGANPLAIDLLGRMLVLDSDQRVSAAEALAHAYFSQYHDPEDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPPEPPKPPGSLEIEQ |
| Protein accession: | AAH27933 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western blot analysis of MAPK11 over-expressed 293 cell line, cotransfected with MAPK11 Validated Chimera RNAi ( Cat # H00005600-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with MAPK11 monoclonal antibody (M03) clone 1F9 (Cat # H00005600-M03 ). GAPDH ( 36.1 kDa ) used as specificity and loading control. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
| Shipping condition: | Dry Ice |