| Brand: | Abnova |
| Reference: | H00005597-M02A |
| Product name: | MAPK6 monoclonal antibody (M02A), clone 4C11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK6. |
| Clone: | 4C11 |
| Isotype: | IgG2b Kappa |
| Gene id: | 5597 |
| Gene name: | MAPK6 |
| Gene alias: | DKFZp686F03189|ERK3|HsT17250|PRKM6|p97MAPK |
| Gene description: | mitogen-activated protein kinase 6 |
| Genbank accession: | BC035492 |
| Immunogen: | MAPK6 (AAH35492, 612 a.a. ~ 721 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EVRKDEQVEKENTYTSYLDKFFSRKEDTEMLETEPVEDGKLGERGHEEGFLNNSGEFLFNKQLESIGIPQFHSPVGSPLKSIQATLTPSAMKSSPQIPHQTYSSILKHLN |
| Protein accession: | AAH35492 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | MAPK6 monoclonal antibody (M02A), clone 4C11 Western Blot analysis of MAPK6 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |