| Brand: | Abnova |
| Reference: | H00005595-M04 |
| Product name: | MAPK3 monoclonal antibody (M04), clone 1F7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant MAPK3. |
| Clone: | 1F7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5595 |
| Gene name: | MAPK3 |
| Gene alias: | ERK1|HS44KDAP|HUMKER1A|MGC20180|P44ERK1|P44MAPK|PRKM3 |
| Gene description: | mitogen-activated protein kinase 3 |
| Genbank accession: | BC013992 |
| Immunogen: | MAPK3 (AAH13992, 279 a.a. ~ 379 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | NYLQSLPSKTKVAWAKLFPKSDSKALDLLDRMLTFNPNKRITVEEALAHPYLEQYYDPTDEPVAEEPFTFAMELDDLPKERLKELIFQETARFQPGVLEAP |
| Protein accession: | AAH13992 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse,Rat |
| Application image: |  |
| Application image note: | MAPK3 monoclonal antibody (M04), clone 1F7. Western Blot analysis of MAPK3 expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,IF,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |