Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PKN2 monoclonal antibody (M01), clone 3A7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
More info about PKN2 monoclonal antibody (M01), clone 3A7
| Brand: | Abnova |
| Reference: | H00005586-M01 |
| Product name: | PKN2 monoclonal antibody (M01), clone 3A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PKN2. |
| Clone: | 3A7 |
| Isotype: | IgG1 kappa |
| Gene id: | 5586 |
| Gene name: | PKN2 |
| Gene alias: | MGC150606|MGC71074|PAK2|PRK2|PRKCL2|PRO2042|Pak-2 |
| Gene description: | protein kinase N2 |
| Genbank accession: | NM_006256 |
| Immunogen: | PKN2 (NP_006247, 580 a.a. ~ 679 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RASSLGEIDESSELRVLDIPGQDSETVFDIQNDRNSILPKSQSEYKPDTPQSGLEYSGIQELEDRRSQQRFQFNLQDFRCCAVLGRGHFGKVLLAEYKNT |
| Protein accession: | NP_006247 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged PKN2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |