| Brand: | Abnova |
| Reference: | H00005584-M02 |
| Product name: | PRKCI monoclonal antibody (M02), clone 3A7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKCI. |
| Clone: | 3A7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 5584 |
| Gene name: | PRKCI |
| Gene alias: | DXS1179E|MGC26534|PKCI|nPKC-iota |
| Gene description: | protein kinase C, iota |
| Genbank accession: | BC022016 |
| Immunogen: | PRKCI (AAH22016, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSHTVAGGGSGDHSHQVRVKAYYRGDIMITHFEPSISFEGLCNEVRDMCSFDNEQLFTMKWIDEEGDPCTVSSQLELEEAFRLYELNKDSELLIHVFPCV |
| Protein accession: | AAH22016 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PRKCI monoclonal antibody (M02), clone 3A7 Western Blot analysis of PRKCI expression in Hela S3 NE ( Cat # L013V3 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |