View larger

PRKCH polyclonal antibody (A02)

Reference:

Condition: New product

Data sheet of PRKCH polyclonal antibody (A02)

Brand:	Abnova
Reference:	H00005583-A02
Product name:	PRKCH polyclonal antibody (A02)
Product description:	Mouse polyclonal antibody raised against a partial recombinant PRKCH.
Gene id:	5583
Gene name:	PRKCH
Gene alias:	MGC26269\|MGC5363\|PKC-L\|PKCL\|PRKCL\|nPKC-eta
Gene description:	protein kinase C, eta
Genbank accession:	NM_006255
Immunogen:	PRKCH (NP_006246, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVAN
Protein accession:	NP_006246
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (37.11 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	PRKCH polyclonal antibody (A02), Lot # 051128JC01 Western Blot analysis of PRKCH expression in A-431 ( Cat # L015V1 ).
Applications:	WB-Ce,ELISA,WB-Re
Shipping condition:	Dry Ice