No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00005583-A02 |
Product name: | PRKCH polyclonal antibody (A02) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant PRKCH. |
Gene id: | 5583 |
Gene name: | PRKCH |
Gene alias: | MGC26269|MGC5363|PKC-L|PKCL|PRKCL|nPKC-eta |
Gene description: | protein kinase C, eta |
Genbank accession: | NM_006255 |
Immunogen: | PRKCH (NP_006246, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MSSGTMKFNGYLRVRIGEAVGLQPTRWSLRHSLFKKGHQLLDPYLTVSVDQVRVGQTSTKQKTNKPTYNEEFCANVTDGGHLELAVFHETPLGYDHFVAN |
Protein accession: | NP_006246 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | PRKCH polyclonal antibody (A02), Lot # 051128JC01 Western Blot analysis of PRKCH expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |