| Brand: | Abnova |
| Reference: | H00005580-M06 |
| Product name: | PRKCD monoclonal antibody (M06), clone 2E12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKCD. |
| Clone: | 2E12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5580 |
| Gene name: | PRKCD |
| Gene alias: | MAY1|MGC49908|PKCD|nPKC-delta |
| Gene description: | protein kinase C, delta |
| Genbank accession: | NM_006254 |
| Immunogen: | PRKCD (NP_006245, 577 a.a. ~ 676 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DILEKLFEREPTKRLGVTGNIKIHPFFKTINWTLLEKRRLEPPFRPKVKSPRDYSNFDQEFLNEKARLSYSDKNLIDSMDQSAFAGFSFVNPKFEHLLED |
| Protein accession: | NP_006245 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to PRKCD on A-431 cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Role of calpain-9 and PKC-delta in the apoptotic mechanism of lumen formation in CEACAM1 transfected breast epithelial cells.Chen CJ, Nguyen T, Shively JE. Exp Cell Res. 2009 Nov 10. [Epub ahead of print] |