Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,IF,WB-Tr |
More info about PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00005571-D01P |
| Product name: | PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human PRKAG1 protein. |
| Gene id: | 5571 |
| Gene name: | PRKAG1 |
| Gene alias: | AMPKG|MGC8666 |
| Gene description: | protein kinase, AMP-activated, gamma 1 non-catalytic subunit |
| Genbank accession: | NM_212461 |
| Immunogen: | PRKAG1 (NP_997626.1, 1 a.a. ~ 247 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP |
| Protein accession: | NP_997626.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PRKAG1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRKAG1 expression in A-431. |
| Applications: | WB-Ce,IF,WB-Tr |
| Shipping condition: | Dry Ice |