> >>PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)
PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P) View larger

PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language
Rate it

Data sheet of PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesRabbit
ApplicationsWB-Ce,IF,WB-Tr

More info about PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00005571-D01P
Product name: PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human PRKAG1 protein.
Gene id: 5571
Gene name: PRKAG1
Gene alias: AMPKG|MGC8666
Gene description: protein kinase, AMP-activated, gamma 1 non-catalytic subunit
Genbank accession: NM_212461
Immunogen: PRKAG1 (NP_997626.1, 1 a.a. ~ 247 a.a) full-length human protein.
Immunogen sequence/protein sequence: MLTITDFINILHRYYKSALVQIYELEEHKIETWREVYLQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFITEFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIYSKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLVVVDENDVVKGIVSLSDILQALVLTGGEKKP
Protein accession: NP_997626.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human
Application image: H00005571-D01P-1-4-1.jpg
Application image note: PRKAG1 MaxPab rabbit polyclonal antibody. Western Blot analysis of PRKAG1 expression in A-431.
Applications: WB-Ce,IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PRKAG1 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart