View larger

PRKACG monoclonal antibody (M02), clone 2F3

Reference:

Condition: New product

Data sheet of PRKACG monoclonal antibody (M02), clone 2F3

Brand:	Abnova
Reference:	H00005568-M02
Product name:	PRKACG monoclonal antibody (M02), clone 2F3
Product description:	Mouse monoclonal antibody raised against a partial recombinant PRKACG.
Clone:	2F3
Isotype:	IgG1 Kappa
Gene id:	5568
Gene name:	PRKACG
Gene alias:	KAPG\|PKACg
Gene description:	protein kinase, cAMP-dependent, catalytic, gamma
Genbank accession:	BC039888
Immunogen:	PRKACG (AAH39888.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAID
Protein accession:	AAH39888.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:	http://www.abnova.com/application_image/
Application image note:	Detection limit for recombinant GST tagged PRKACG is approximately 10ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA
Shipping condition:	Dry Ice