View larger

PRKACG polyclonal antibody (A01)

Reference:

Condition: New product

Data sheet of PRKACG polyclonal antibody (A01)

Brand	Abnova
Product type	Primary antibodies
Reactivity	Human
Host species	Mouse
Applications	ELISA,WB-Re

More info about PRKACG polyclonal antibody (A01)

Brand:	Abnova
Reference:	H00005568-A01
Product name:	PRKACG polyclonal antibody (A01)
Product description:	Mouse polyclonal antibody raised against a full-length recombinant PRKACG.
Gene id:	5568
Gene name:	PRKACG
Gene alias:	KAPG\|PKACg
Gene description:	protein kinase, cAMP-dependent, catalytic, gamma
Genbank accession:	BC039888
Immunogen:	PRKACG (AAH39888, 1 a.a. ~ 351 a.a) full-length recombinant protein with GST tag.
Immunogen sequence/protein sequence:	MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCPKEFSEF
Protein accession:	AAH39888
Storage buffer:	50 % glycerol
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (64.72 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Applications:	ELISA,WB-Re
Shipping condition:	Dry Ice
Publications:	Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.Adachi A, Kano F, Saido TC, Murata M. Genes Cells. 2009 Mar;14(3):355-69. Epub 2009 Feb 13.

Reviews

Be the first to write your review !

Buy PRKACG polyclonal antibody (A01) now

Add to cart