Cart 64 Product Products 14 490,06 € (empty)
-
1 x c-Fos...259,07 € -
1 x COL5A1...259,07 € -
-
1 x Clock...259,07 € -
-
-
-
-
-
1 x c-Fms...259,07 € -
-
-
-
-
-
-
-
1 x COL11A2...259,07 € -
-
-
-
-
1 x c-Fms...259,07 € -
1 x c-Myc...259,07 € -
-
-
-
-
-
-
1 x Cdk8...259,07 € -
-
-
1 x c-Fos...259,07 € -
1 x CLIC4...259,07 € -
1 x c-Myc...259,07 € -
-
1 x c-Fos...259,07 € -
1 x CLC-KA...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
1 x CLK4...259,07 € -
1 x c-Myc...259,07 € -
-
-
-
1 x c-Fgr...259,07 € -
-
-
-
-
-
-
-
No products
To be determined Shipping
14 490,06 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 64 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 14 490,06 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 14 490,06 €
Data sheet of PRKACG polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about PRKACG polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00005568-A01 |
| Product name: | PRKACG polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a full-length recombinant PRKACG. |
| Gene id: | 5568 |
| Gene name: | PRKACG |
| Gene alias: | KAPG|PKACg |
| Gene description: | protein kinase, cAMP-dependent, catalytic, gamma |
| Genbank accession: | BC039888 |
| Immunogen: | PRKACG (AAH39888, 1 a.a. ~ 351 a.a) full-length recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MGNAPAKKDTEQEESVNEFLAKARGDFLYRWGNPAQNTASSDQFERLRTLGMGSFGRVMLVRHQETGGHYAMKILNKQKVVKMKQVEHILNEKRILQAIDFPFLVKLQFSFKDNSYLYLVMEYVPGGEMFSRLQRVGRFSEPHACFYAAQVVLAVQYLHSLDLIHRDLKPENLLIDQQGYLQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAVGFPPFYADQPIQIYEKIVSGRVRFPSKLSSDLKHLLRSLLQVDLTKRFGNLRNGVGDIKNHKWFATTSWIAIYEKKVEAPFIPKYTGPGDASNFDDYEEEELRISINEKCPKEFSEF |
| Protein accession: | AAH39888 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (64.72 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Visual screening and analysis for kinase-regulated membrane trafficking pathways that are involved in extensive beta-amyloid secretion.Adachi A, Kano F, Saido TC, Murata M. Genes Cells. 2009 Mar;14(3):355-69. Epub 2009 Feb 13. |