| Brand: | Abnova |
| Reference: | H00005567-M02 |
| Product name: | PRKACB monoclonal antibody (M02), clone 1F8 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant PRKACB. |
| Clone: | 1F8 |
| Isotype: | IgG2a Kappa |
| Gene id: | 5567 |
| Gene name: | PRKACB |
| Gene alias: | DKFZp781I2452|MGC41879|MGC9320|PKACB |
| Gene description: | protein kinase, cAMP-dependent, catalytic, beta |
| Genbank accession: | BC016285 |
| Immunogen: | PRKACB (AAH16285, 1 a.a. ~ 257 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MGNAATAKKGSEVESVKEFLAKAKEDFLKKWENPTQNNAGLEDFERKKTLGTGSFGRVMLVKHKATEQYYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVRLEYAFKDNSNLYMVMEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDHQGYIQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVSGKNF |
| Protein accession: | AAH16285 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |