No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re,PLA-Ce |
Brand: | Abnova |
Reference: | H00005566-M02 |
Product name: | PRKACA monoclonal antibody (M02), clone 1D7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PRKACA. |
Clone: | 1D7 |
Isotype: | IgG1 Kappa |
Gene id: | 5566 |
Gene name: | PRKACA |
Gene alias: | MGC102831|MGC48865|PKACA |
Gene description: | protein kinase, cAMP-dependent, catalytic, alpha |
Genbank accession: | BC039846 |
Immunogen: | PRKACA (AAH39846, 1 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWESPAQNTAHLDQFERIKTLGTGSFGRVMLVKHKETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV |
Protein accession: | AAH39846 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (38.94 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged PRKACA is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re,PLA-Ce |
Shipping condition: | Dry Ice |